IGF-1 LR3
✓ You're on the list — we'll email you when it's back in stock.
Notify me when back in stock
This product is sold for in-vitro research purposes only. It is not a drug, food, cosmetic or supplement. Not for human or animal consumption.
| Compound | IGF-1 LR3 |
| Sequence / formula | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| SKU | IG01 |
| Vial size | 0.1mg |
| Stock | 0 units |
Overview
IGF-1 LR3 (Long Arginine 3-IGF-1) is a synthetic and lengthened protein analogue of human-like-insulin growth factor 1. It is comprised of 83 amino acids. Dosed at 1 mg for research purposes.
Disclaimer
Apex Biohacks does not provide medical advice, treatment guidance or dosing recommendations. The information here describes published research only.
What's in every CoA
Every lot is shipped to an independent ISO-17025 accredited lab and tested before it leaves the facility.
- HPLC purity quantification
- Mass spec confirmation (MALDI-TOF)
- Endotoxin testing (LAL)
- Bioburden / sterility
- Appearance & moisture content
- Lot, manufacture & test dates
Suggested reconstitution
Slowly add the bacteriostatic water of your choice to the lyophilized peptide. Swirl gently — do not shake.
| Vial | 0.1mg |
| BAC water | 2.0 mL |
| Resulting concentration | 0.05 mg / mL |
| Per 10 IU on U-100 syringe | 0.005 mg |
Need exact numbers?
The dosing calculator works out reconstitution volumes, draw amounts and concentrations for any vial size + diluent combo.
Open the calculator →What the lab says
Often researched together
CoA verified
CoA verified
CoA on request
Before you order IGF-1 LR3.
Handling, documentation and shipping details for this compound.
No. IGF-1 LR3 is supplied strictly for in-vitro laboratory research. It is not a drug, supplement, food or cosmetic and must not be used in or on humans or animals.
Each lot is assayed by an independent laboratory for HPLC purity, mass-spec identity and endotoxin. The Certificate of Analysis is published to our CoA library as soon as the lot clears testing.
Lyophilised vials should be kept sealed, protected from light, at −20 °C for long-term storage (2–8 °C short term). Once reconstituted, store at 2–8 °C and use within the period stated on the CoA.
Orders ship in insulated, tracked mailers from our EU warehouse. Typical delivery is 3–5 business days within the shipping zones listed at checkout.